PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00038.1_g00019.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family bZIP
Protein Properties Length: 185aa    MW: 21556.7 Da    PI: 5.6502
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00038.1_g00019.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_140.36.7e-1387137555
                              CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                   bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkke 55 
                              +++rr+ +NRe+ArrsR RK+  ++eL   v  L +eN +L ++l++ +++
  Rsa1.0_00038.1_g00019.1  87 RKQRRMLSNRESARRSRMRKQRHLDELWSQVIRLRNENNSLVDKLNRVSET 137
                              79********************************************99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003387.8E-1583147IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.95585148IPR004827Basic-leucine zipper domain
SuperFamilySSF579593.3E-1287136No hitNo description
PfamPF001701.2E-1087137IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1704.6E-1187159No hitNo description
CDDcd147024.45E-1788136No hitNo description
PROSITE patternPS00036090105IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 185 aa     Download sequence    Send to blast
MIPAEITGYY QYILPETLTT IPAEFNILNM PSSPTSSSSL NYLNDLINNN NNYSLSSNSQ  60
DYMMSNNSTS DEDHHQHHQS IMALDERKQR RMLSNRESAR RSRMRKQRHL DELWSQVIRL  120
RNENNSLVDK LNRVSETQGS VLKENSELKE EVSDLRRLVC ELKSNKNNNN NNNDNNSFVS  180
EFEDV
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
199106RRSRMRKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013741232.14e-99PREDICTED: basic leucine zipper 43-like
TrEMBLA0A078H6H78e-99A0A078H6H7_BRANA; BnaA09g19470D protein
STRINGBra017359.1-P1e-86(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM28922469
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G04038.12e-64basic leucine-zipper 48